Cart summary

You have no items in your shopping cart.

RecombinantTWEAK,Human

SKU: orb1494661

Description

TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.
Molecular Weight20-22 kDa, observed by reducing SDS-PAGE.
Protein SequenceRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Human TWEAK remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNF-related weak inducer of apoptosis, TNFSF12, DR3LG, Apo3-Ligand
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantTWEAK,Human (orb1494661)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 180.00
50 μg
$ 450.00