Cart summary

You have no items in your shopping cart.

RecombinantOSM,Mouse(HEK293-expressed)

RecombinantOSM,Mouse(HEK293-expressed)

Catalog Number: orb1494628

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494628
CategoryProteins
DescriptionOncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR
MW10-40 kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceHEK 293
Biological ActivityED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.
StorageLyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesOncostatin M
NoteFor research use only