RecombinantOSM,Mouse(HEK293-expressed)

• Catalog Number: orb1494628
• Category: Proteins
• Description: Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Protein Sequence: ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR
• MW: 10-40 kDa, observed by reducing SDS-PAGE.
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Source: HEK 293
• Biological Activity: ED50 < 0.4 ng/ml, measured in a cell proliferation assay using NIH-3T3 cells.
• Storage: Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Alternative names: Oncostatin M
• Note: For research use only
• Expiration Date: 6 months from date of receipt.