You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494680 |
---|---|
Category | Proteins |
Description | Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1β is a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1β has been shown to interact with CCL3. It can signal through the CCR5 receptor.Recombinant MIP-1 beta/CCL4 produced in CHO is a polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 10-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
Protein Sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN |
MW | 10-19 kDa, observed by reducing SDS-PAGE. |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Source | CHO |
Biological Activity | The EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml. |
Storage | Lyophilized recombinant Human MIP-1β/CCL4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1β/CCL4 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
Alternative names | MIP1β, Macrophage Inflammatory Protein-1β, CCL4, A Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 95% as analyzed by SDS-PAGE and HPLC. | |
7.6 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |