You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494692 |
---|---|
Category | Proteins |
Description | Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
Protein Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
MW | ~9 kDa, observed by reducing SDS-PAGE |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Source | CHO |
Biological Activity | ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1. |
Storage | Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Alternative names | Interleukin-8, IL8, XCL8, monocyte-derived neutrop Read more... |
Note | For research use only |