Cart summary

You have no items in your shopping cart.

RecombinantIL-6R,Human

RecombinantIL-6R,Human

Catalog Number: orb1494696

DispatchUsually dispatched within 5-10 working days
$ 320.00
Catalog Numberorb1494696
CategoryProteins
DescriptionInterleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP
MW54-56 kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.
StorageLyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesIL-6RA, IL-6R1, CD126
NoteFor research use only