You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494636 |
---|---|
Category | Proteins |
Description | Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Purity | > 95% as analyzed by SDS-PAGE. |
Purification | > 95% as analyzed by SDS-PAGE. |
Protein Sequence | FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT |
MW | 21~26 kDa , observed by reducing SDS-PAGE. |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Source | HEK 293 |
Biological Activity | ED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells. |
Storage | Lyophilized recombinant Rat Interleukin-6(IL-6) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, it should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Alternative names | Interleukin-6, IL6 |
Note | For research use only |