You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494714 |
---|---|
Category | Proteins |
Description | Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Purity | > 95% as analyzed by SDS-PAGE. |
Purification | > 95% as analyzed by SDS-PAGE. |
Protein Sequence | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNA EGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
MW | 15-22 kDa, observed by reducing SDS-PAGE. |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Source | CHO |
Biological Activity | Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes. |
Storage | Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Alternative names | Interleukin-17A; IL-17A |
Note | For research use only |