RecombinantIL-17A,His,Human

• Catalog Number: orb1494715
• Category: Proteins
• Description: Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• Purification: > 95% as analyzed by SDS-PAGE.
• Protein Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
• MW: 14-22 kDa, observed by reducing SDS-PAGE.
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Source: CHO
• Biological Activity: ED50 3.3×10ˆ6 units/mg.
• Storage: Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Alternative names: Interleukin-17A; IL-17A
• Note: For research use only