You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | ED50 < 5 ng/ml, measured in a proliferation assay using T11 cells. |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | ~23 kDa, observed by reducing SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Protein Sequence | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADL LSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGL HLTLDWAVRGLLLLKTRL |
Storage & Handling
−| Storage | Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-11, IL11

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide