Cart summary

You have no items in your shopping cart.

RecombinantIL-11,Human(CHO-expressed)

RecombinantIL-11,Human(CHO-expressed)

Catalog Number: orb1494720

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1494720
CategoryProteins
DescriptionInterleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequencePGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADL LSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGL HLTLDWAVRGLLLLKTRL
MW~23 kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 < 5 ng/ml, measured in a proliferation assay using T11 cells.
StorageLyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesInterleukin-11, IL11
NoteFor research use only