Cart summary

You have no items in your shopping cart.

RecombinantIL-10,Rat(CHO-expressed)

RecombinantIL-10,Rat(CHO-expressed)

Catalog Number: orb1494721

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494721
CategoryProteins
DescriptionInterleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQA ENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
MW8-22 kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 < 8μg /ml, measured in a bioassay using C6 cells.
StorageLyophilized recombinant rat Interleukin-10(IL-10) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesInterleukin-10, IL10
NoteFor research use only