Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant IFN-β, Human

SKU: orb1494646

Description

Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceHEK 293
Biological ActivityED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.
Purification> 95% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.
MW~23 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Protein SequenceMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN

Storage & Handling

StorageLyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Leukocyte interferon, B cell interferon, Type I interferon

Similar Products

  • Recombinant Rat Interferon-γ (rRtFN-γ) [orb1495057]

    >95% by SDS-PAGE and HPLC analyses.

    Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.

    Escherichia coli.

    1 mg, 100 μg, 20 μg
  • Recombinant Murine Interferon-γ (rMuIFN-γ) [orb1495059]

    >95% by SDS-PAGE and HPLC analyses

    Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.

    Escherichia coli.

    1 mg, 20 μg, 100 μg
  • Recombinant Human Interferon-γ (rHuIFN-γ) [orb1495064]

    >98% by SDS-PAGE and HPLC analyses.

    Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.

    Escherichia coli

    1 mg, 20 μg, 100 μg
  • Recombinant Human IFNB1 [orb1098922]

    ELISA,  WB

    Greater than 90% by SDS-PAGE gel analyses

    40.7 kDa

    E.Coli

    200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Recombinant IFN-β, Human (orb1494646)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 200.00
25 μg
$ 530.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry