Cart summary

You have no items in your shopping cart.

RecombinantG-CSF,Mouse

RecombinantG-CSF,Mouse

Catalog Number: orb1494741

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494741
CategoryProteins
DescriptionGranulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAI SYLQGFLETARLALHHLA
MW22-24 kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 < 0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells.
StorageLyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesGranulocyte Colony-Stimulating Factor, CSF-3, CSF3
Read more...
NoteFor research use only