Cart summary

You have no items in your shopping cart.

RecombinantFractalkine/CX3CL1,Rat

SKU: orb1494649

Description

Chemokine (C-X3-C motif) ligand 1 (CX3CL1) is a large cytokine protein of 373 amino acids. It contains multiple domains and is the only known member of the CX3C chemokine family. It is also commonly known under the names fractalkine (in humans) and neurotactin (in mice). The polypeptide structure of CXC3L1 differs from the typical structure of other chemokines. For example, the spacing of the characteristic N-terminal cysteinesis different; there are three amino acids separating the initial pair of cysteines in CX3CL1, while there are none in CC chemokines and only one in CXC chemokines. CX3CL1 is produced as a long protein (with 373-amino acid in humans) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk allows it to bind to the surface of certain cells. Soluble CX3CL1 potently chemoattracts T cells and monocytes, while the cell-bound chemokine promotes strong adhesion of leukocytes to activated endothelial cells, where it is primarily expressed. CX3CL1 can signal through the chemokine receptor CX3CR1.Recombinant rat Fractalkine/CX3CL1 produced in HEK293 cells is a polypeptide chain containing 310 amino acids. A fully biologically active molecule, rrFractalkine/CX3CL1 has a molecular mass of 70-90 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100μg/ml.

Key Properties

SourceHEK 293
Biological ActivityThe EC50 value of rat Fractalkine/CX3CL1 on Caˆ2+ mobilization assay in CHO-K1/G15/rCX3CR1 cells (human G15 and rat CX3CR1 stably expressed in CHO-K1 cells) is less than 1 g/ml.
Molecular Weight70-90 kDa, observed by reducing SDS-PAGE.
Protein SequenceQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNGGKFE KRVDNVTPRITSATRGLSPTALAKPESATVEDLTLEPTAISQEARRPMGTSQEPPAAVTGSSPSTSKAQDAGLAAKPQST GISEVAAVSTTIWPSSAVYQSGSSLWAEEKATESPPTIALSTQASTTSSPKQNVGSEGQPPWVQEQDSTPEKSPGPEETN PVHTDIFQDRGPGSTVHPSVAPTSSEKTPSPELVASGSQAPKVEEPIHATADPQKLSVFITPVPDSQAAT
Purification> 98% as analyzed by SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Rat Fractalkine/CX3CL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat Fractalkine/CX3CL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Fractalkine, CX3CL1
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantFractalkine/CX3CL1,Rat (orb1494649)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 180.00
50 μg
$ 450.00