Recombinant Tick-borne encephalitis virus European subtype Genome polyprotein, partial

SKU: orb2658272

Description

This Recombinant Tick-borne encephalitis virus European subtype Genome polyprotein, partial spans the amino acid sequence from region 281-727aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Baculovirus
• Biological Origin: Tick-borne encephalitis virus European subtype (strain Neudoerfl) (NEUV) (Neudoerfl virus)
• Tag: C-terminal 6xHis-tagged
• Molecular Weight: 49.4 kDa
• Expression Region: 281-727aa
• Protein Length: Partial
• Protein Sequence: SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGRVFQKTKKGIERLTVIGEHAWDFGSAGGFLSSIGKAVHTVLGGAFNS
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Core protein;Matrix protein;NS1;NS2A;Flavivirin protease NS2B regulatory subunit;Non-structural protein 2B;Flavivirin protease NS3 catalytic subunit;Non-structural protein 3;NS4A;NS4B;Non-structural protein 5

Quick Database Links

UniProt

P14336