You have no items in your shopping cart.
Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Streptococcus sp. group G |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 31.2 kDa |
| Expression Region | 291-497aa |
| Protein Length | Partial |
| Protein Sequence | IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.200. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial [orb2658007]
Greater than 85% as determined by SDS-PAGE.
29.4 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial [orb2659303]
Greater than 95% as determined by SDS-PAGE.
26.6 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg) , partial [orb2986868]
Greater than 95% as determined by SDS-PAGE.
24.0 kDa
Mammalian cell
20 μg, 1 mg, 100 μgRecombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial [orb2986258]
Greater than 85% as determined by SDS-PAGE.
32.7 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial [orb2666496]
Greater than 85% as determined by SDS-PAGE.
29.9 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial (orb3155846)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
