Cart summary

You have no items in your shopping cart.

Recombinant Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase(SLC1)

Recombinant Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase(SLC1)

Catalog Number: orb2926923

Select Product Size
SizePriceQuantity
20 μg$ 1,940.00
100 μg$ 3,160.00
20 μg Enquire
100 μg Enquire
DispatchUsually dispatched within 15-40 working days
Product Properties
Catalog Numberorb2926923
CategoryProteins
DescriptionRecombinant Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase(SLC1)
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein SequenceMSVIGRFLYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQWITARCFYHVMKLMLG LDVKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALS GTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQ GKIPIVPVVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVD TLKEIGYSPAINDTTLPPQAIEYAALQHDKKVNKKIKNEPVPSVSISNDVNTHNEGSSVK KMH
Protein Lengthfull length protein
UniProt IDP33333
Biological OriginSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region1-303
StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Alternative namesProbable 1-acyl-sn-glycerol-3-phosphate acyltransf
Read more...
NoteFor research use only
Images
Reviews

Recombinant Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase(SLC1) (orb2926923)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet