You have no items in your shopping cart.
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 μg/mL can bind Anti-LY6G6D recombinant antibody. The EC50 is 4.245-5.843 μg/mL. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 11.7 kDa |
| Expression Region | 20-108aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody. The EC50 is 6.238-7.258 ng/mL.

The purity of Ly6g6d was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) (orb1785093)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review