Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial, Fluorescent-VLPs

SKU: orb2658163

Description

This Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial-VLPs, Fluorescent spans the amino acid sequence from region 396-800aa. Purity: The purity information is not available for VLPs proteins.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

• Source: Mammalian cell
• Biological Origin: Rattus norvegicus (Rat)
• Tag: C-terminal EGFP-tagged
• Molecular Weight: 73.3 kDa
• Expression Region: 396-800aa
• Protein Length: Partial
• Protein Sequence: TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
• Purity: The purity information is not available for VLPs proteins.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Disclaimer: For research use only

Alternative Names

GluN1;Glutamate [NMDA] receptor subunit zeta-1;N-methyl-D-aspartate receptor subunit NR1;NMD-R1

Detected by Mouse anti-GFP monoclonal antibody.

Quick Database Links

UniProt

P35439