You have no items in your shopping cart.
Cart summary
Item 1 of 1
Recombinant Rabies virus Glycoprotein G (G), partial
Catalog Number: orb1881891
| Catalog Number | orb1881891 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rabies virus Glycoprotein G (G), partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 56.6 kDa |
| UniProt ID | O92284 |
| Protein Sequence | KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKY |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | RJA-Rabies virus (strain CVS-11) (RABV) |
| Expression Region | 20-459aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Virus G protein [orb604614]
Greater than 85% as determined by SDS-PAGE.
49.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Virus G protein [orb604818]
Greater than 90% as determined by SDS-PAGE.
55.0 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Virus G protein [orb604613]
Greater than 85% as determined by SDS-PAGE.
55.5 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Rabies virus Glycoprotein (G), partial, Biotinylated [orb2658690]
Greater than 90% as determined by SDS-PAGE.
97.3 kDa
E.coli
1 mg, 20 μg, 100 μg 
