Recombinant Pseudomonas aeruginosa Pseudolysin(lasB),partial

SKU: orb1631298

This product can be custom made

Description

Images & Validation

−

Key Properties

−

Expression System	E.coli
Tag	N-terminal 6xHis-SUMO-tagged
Expression Region	198-498aa (AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL)
MW	49.1 kDa
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Tris-based buffer50% glycerol
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain: Pro-elastase

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P14756

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols