You have no items in your shopping cart.
Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)
SKU: orb3155927
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 1-100aa |
| Protein Length | Full Length |
| MW | 12.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−10 kDa chaperonin;Chaperonin-10
Similar Products
−Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES) [orb2658620]
Greater than 85% as determined by SDS-PAGE.
37.5 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES) [orb3003967]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES) (orb3155927)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review