You have no items in your shopping cart.
Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | Tag-Free |
| Expression Region | 38-175aa |
| Protein Length | Full Length of Mature Protein |
| MW | 15.6 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse Reg3b Protein, N-GST & C-His [orb2964334]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
43.09 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse Reg3b Protein, C-His [orb2961589]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.55 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse Reg3b Protein, C-Fc [orb2961590]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
45.88 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) [orb1881706]
Greater than 95% as determined by SDS-PAGE.
28.4 kDa
E.coli
1 mg, 20 μg, 100 μgRecombinant Mouse Reg3b Protein, N-GST & C-His [orb2831620]
>90% as determined by SDS-PAGE.
43.09 kDa
20 μg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) (orb2659685)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review