Recombinant Mouse Peroxiredoxin-6 (Prdx6)

SKU: orb2659162

Description

This Recombinant Mouse Peroxiredoxin-6 (Prdx6) spans the amino acid sequence from region 2-224aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Metabolism Research

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: C-terminal 6xHis-tagged
• Expression Region: 2-224aa
• Protein Length: Full Length of Mature Protein
• MW: 31.7 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

1-Cys peroxiredoxin;1-Cys PRX;Acidic calcium-independent phospholipase A2;aiPLA2;EC 3.1.1.4;Antioxidant protein 2;Glutathione-dependent peroxiredoxin;Lysophosphatidylcholine acyltransferase 5;LPC acyltransferase 5;LPCAT-5;Lyso-PC acyltransferase 5;EC 2.3.1.23;Non-selenium glutathione peroxidase;NSGPx

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

O08709