Recombinant Mouse Melanocyte-stimulating hormone receptor (Mc1r)-VLPs

SKU: orb1785338

Description

This Recombinant Mouse Melanocyte-stimulating hormone receptor (Mc1r)-VLPs spans the sequence from region 1-315aa.

Research Area

Metabolism Research

Images & Validation

• Application Notes:
  VLP proteins are unsuitable for ligand-receptor studies due to interfering envelope proteins. For SPR/BLI, use a Vesicle Capture chip or a dual-antibody sandwich method on a standard chip. Chip-free alternatives like MST are also viable.

Key Properties

• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Expression Region: 1-315aa
• Protein Length: Full Length
• MW: 36.6 kDa
• Protein Sequence: MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Reconstitution: Briefly centrifuge the vial before opening. Reconstitute protein in deionized water to 0.1-1.0 mg/mL. Aliquot and store at -80°C. For solubilization, gently mix at room temperature for 60 minutes; avoid vigorous shaking.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

(MSH-R)(Melanocortin receptor 1)(MC1-R)

Quick Database Links

UniProt

Q01727