You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2657916 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Leukemia inhibitory factor (Lif) (Active) |
Tag | Tag free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 19.9 kDa |
UniProt ID | P09056 |
Protein Sequence | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml. |
Expression Region | 24-203aa |
Endotoxins | ≤10 EU/mg by the LAL method |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS,5%mannitoland0.01% Tween 80, pH 7.4 |
Alternative names | Leukemia Inhibitory Factor; LIF; Differentiation-S Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
> 95% as analyzed by SDS-PAGE and HPLC. | |
20.5 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |