You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623195 |
---|---|
Category | Proteins |
Description | Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Mouse IL-2 Recombinant Protein is purified interleukin-2 produced in yeast. |
Form/Appearance | Lyophilized |
MW | 17.6 kDa |
Protein Sequence | APTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153) |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Application notes | The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control. |
Expiration Date | 6 months from date of receipt. |
> 95% as determined by SDS-PAGE and HPLC. | |
17.2 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
17.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
29.3 kDa | |
E.coli |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |