Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-2

SKU: orb623195

Description

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Mouse IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
MW17.6 kDa
Protein SequenceAPTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Mouse IL-2RA Protein [orb2994413]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 25.5 KDa. Observed: 40-60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse IL-2RA Protein [orb2994437]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 51.6 KDa. Observed: 60-90 KDa, reducing conditions

    50 μg, 500 μg, 1 mg, 10 μg
  • Recombinant Mouse IL-2RB Protein [orb2993765]

    Unconjugated

    SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.

    Predicted: 26.1 KDa. Observed: 40-60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse IL-2RB Protein [orb2993766]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 52.2 KDa. Observed: 70-110 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • CD25 Mouse Monoclonal Antibody [orb2988306]

    IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry