You have no items in your shopping cart.
Recombinant Mouse IL-2
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Molecular Weight | 17.6 kDa |
| Protein Sequence | APTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Mouse IL-2RB Protein [orb2993765]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 26.1 KDa. Observed: 40-60 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgRecombinant Mouse IL-2RB Protein [orb2993766]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 52.2 KDa. Observed: 70-110 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse IL-2RA Protein [orb2994437]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 51.6 KDa. Observed: 60-90 KDa, reducing conditions
10 μg, 50 μg, 1 mg, 500 μgRecombinant Mouse IL-2RA Protein [orb2994413]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 25.5 KDa. Observed: 40-60 KDa, reducing conditions
10 μg, 50 μg, 1 mg, 500 μgRecombinant mouse IL2RA protein, C-His (HEK293) [orb1817210]
>90% as determined by SDS-PAGE
25.7 kDa
500 μg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Recombinant Mouse IL-2 (orb623195)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review