Cart summary

You have no items in your shopping cart.

Recombinant Mouse IL-2

SKU: orb623195

Description

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Mouse IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Images & Validation

Application Notes
The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
Molecular Weight17.6 kDa
Protein SequenceAPTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Mouse IL-2RB Protein [orb2993765]

    Unconjugated

    SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.

    Predicted: 26.1 KDa. Observed: 40-60 KDa, reducing conditions

    1 mg, 10 μg, 50 μg, 500 μg
  • Recombinant Mouse IL-2RB Protein [orb2993766]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 52.2 KDa. Observed: 70-110 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse IL-2RA Protein [orb2994437]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 51.6 KDa. Observed: 60-90 KDa, reducing conditions

    10 μg, 50 μg, 1 mg, 500 μg
  • Recombinant Mouse IL-2RA Protein [orb2994413]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 25.5 KDa. Observed: 40-60 KDa, reducing conditions

    10 μg, 50 μg, 1 mg, 500 μg
  • Recombinant mouse IL2RA protein, C-His (HEK293) [orb1817210]

    >90% as determined by SDS-PAGE

    25.7 kDa

    500 μg, 20 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Mouse IL-2 (orb623195)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry