You have no items in your shopping cart.
Recombinant Mouse Growth/differentiation factor 15 (Gdf15)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 25.5 kDa |
| Expression Region | 189-303aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse GDF15 [orb3002283]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 16.9 KDa. Observed: 14-16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse Growth/differentiation factor 15 (Gdf15) [orb2659506]
Greater than 95% as determined by SDS-PAGE.
39.9 kDa
Mammalian cell
20 μg, 1 mg, 100 μgRecombinant Mouse GDF15/MIC1 Protein, N-His-SUMO [orb2964441]
>90% as determined by SDS-PAGE.
23.47 kDa
1 mg, 100 μg, 50 μgGDF15 Antibody [orb2629732]
WB
Human
Mouse
Monoclonal
Unconjugated
Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO [orb2831691]
>90% as determined by SDS-PAGE.
23.47 kDa
20 μg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse Growth/differentiation factor 15 (Gdf15) (orb2659851)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
