You have no items in your shopping cart.
Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 16.1 kDa |
| Expression Region | 18-141aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse GM-CSF [orb3002488]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.2 KDa. Observed: 15 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse GM-CSF [orb3002464]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 15.1 KDa. Observed: 18-30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) [orb1674518]
Greater than 90% as determined by SDS-PAGE.
18.2 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Mouse CSF2/GM-CSF Protein, C-His [orb2966266]
>90% as determined by SDS-PAGE.
17.06 kDa
1 mg, 100 μg, 50 μgRecombinant Mouse CSF2/GM-CSF Protein, N-His [orb2962498]
>90% as determined by SDS-PAGE.
16.41 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (orb2659791)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
