You have no items in your shopping cart.
Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Biological Activity | Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime). |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 16.4 kDa |
| Expression Region | 29-159aa(R127A,R130S) |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active) (orb2659839)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review