Cart summary

You have no items in your shopping cart.

Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK(nisK)

Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK(nisK)

Catalog Number: orb2924771

Select Product Size
SizePriceQuantity
20 μg$ 2,150.00
100 μg$ 3,370.00
20 μg Enquire
100 μg Enquire
DispatchUsually dispatched within 15-40 working days
Product Properties
Catalog Numberorb2924771
CategoryProteins
DescriptionRecombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK(nisK)
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein SequenceMGKKYSMRRRIWQAVIEIIIGTCLLILLLLGLTFFLRQIGQISGSETIRLSLDSDNLTIS DIERDMKHYPYDYIIFDNDTSKILGGHYVKSDVPSFVASKQSSHNITEGEITYTYSSNKH FSVVLRQNSMPEFTNHTLRSISYNQFTYLFFFLGEIILIIFSVYHLIREFSKNFQAVQKI ALKMGEITTFPEQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDV KTPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDENDYKAT ISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAKE GEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQG VALKHQGNLILSNPQKGGAEVILKIKK
Protein Lengthfull length protein
UniProt IDP42707
Biological OriginLactococcus lactis subsp. lactis (Streptococcus lactis)
Expression Region1-447
StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Alternative namesNisin biosynthesis sensor protein nisK, EC= 2.7.13
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.
Images
Reviews

Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK(nisK) (orb2924771)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet