You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb3009820 |
|---|---|
| Category | Proteins |
| Description | This Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE. |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
| Protein Length | 95 |
| UniProt ID | Q9Y333 |
| Expression System | E.coli |
| Endotoxins | Not test |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-95 |
| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
| Alternative names | U6 snRNA-associated Sm-like protein LSm2; Protein Read more... |
| Note | For research use only |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
10.3 kDa | |
E.Coli |
Greater than 85% as determined by SDS-PAGE. |
Greater than 85% as determined by SDS-PAGE. |
Greater than 85% as determined by SDS-PAGE. |
Greater than 85% as determined by SDS-PAGE. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review