Category | Proteins |
---|---|
Catalog Number | orb1096435 |
Reactivity | Human |
MW | 36.9 kDa |
Application notes | Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
UniProt ID | Q96BD6 |
Protein Sequence | MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ |
Tag | N-terminal 6xHis-tagged |
Source | E.coli |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin | Not test. |
Note | For research use only. |
Expiration Date | 6 months from date of receipt. |
Description | Recombinant Human SPRY domain-containing SOCS box protein 1(SPSB1) |
- Recombinant Human SPRY domain-containing SOCS box protein 1(SPSB1) [orb1096069]
E.coli
36.0 kDa
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg