Recombinant Human Putative inactive neutral ceramidase B(ASAH2B)

SKU: orb1653280

Description

Images & Validation

−

Key Properties

−

Expression System	E.coli
Tag	N-terminal 6xHis-tagged
Molecular Weight	23 kDa
Protein Sequence	MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Tris-based buffer50% glycerol
Disclaimer	For research use only

Alternative Names

−

ASAH2-like protein;Putative inactive N-acylsphingosine amidohydrolase 2B;Putative inactive non-lysosomal ceramidase B

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P0C7U1

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols