You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 2-290 |
| Protein Length | 289 |
| Endotoxins | Not test |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | APKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human B7-H4 Protein (Biotin) [orb2993778]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 54.1 KDa. Observed: 70-95 KDa, reducing conditions
20 μg, 100 μgRecombinant Human TIGIT Protein (Biotin) [orb2993945]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 15.9 KDa. Observed: 17-23 KDa, reducing conditions
20 μg, 100 μgRecombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial, Biotinylated [orb2280243]
Greater than 95% as determined by SDS-PAGE.
23.0 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human T-cell immunoreceptor with Ig and ITIM domains(TIGIT), partial, Biotinylated [orb2986015]
Greater than 90% as determined by SDS-PAGE.
32.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Protein SETSIP (SETLP), Biotinylated [orb3008940]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Protein SET (SET), Biotinylated (orb3008847)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review