You have no items in your shopping cart.
Recombinant Human Prostaglandin G/H synthase 1 (PTGS1)
SKU: orb2666576
Featured
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 71 kDa |
| Expression Region | 24-599aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | ADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cyclooxygenase-1;COX-1;Prostaglandin H2 synthase 1;PGH synthase 1;PGHS-1;PHS 1;Prostaglandin-endoperoxide synthase 1
Similar Products
−Recombinant Human PTGS1 Protein, N-His [orb2968886]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
28.83 kDa
1 mg, 50 μg, 100 μgRecombinant Human Prostaglandin G/H synthase 1 (PTGS1) [orb2986732]
Greater than 85% as determined by SDS-PAGE.
72.9 kDa
E.coli
100 μg, 1 mg, 20 μgRecombinant Human PTGS1 Protein, N-His [orb2836165]
>90% as determined by SDS-PAGE.
28.84 kDa
20 μg, 50 μg, 100 μgRecombinant human Cyclooxygenase 1 protein, N-His [orb2837177]
>90% as determined by SDS-PAGE
44 kDa
100 μg, 500 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Prostaglandin G/H synthase 1 (PTGS1) (orb2666576)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
