You have no items in your shopping cart.
Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial
SKU: orb3053901
Description
Research Area
Cardiovascular Research; Immunology & Inflammation; Musculoskeletal & Connective Tissue Research
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 8-164aa |
| Protein Length | Partial |
| Endotoxins | Not test |
| MW | 21.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cardiac myosin light chain-2; Cardiac ventricular myosin light chain 2; CMH10; MLC 2v ; MLC-2; MLC-2v; MLC2; MLRV_HUMAN; MYL 2; MYL2; Myosin light chain 2 regulatory cardiac slow; Myosin light polypeptide 2 regulatory cardiac slow; Myosin regulatory light chain 2; Myosin regulatory light chain 2 ventricular/cardiac muscle isoform; Regulatory light chain of myosin; RLC of myosin; Slow cardiac myosin regulatory light chain 2; ventricular/cardiac muscle isoform
Similar Products
−Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform(MYL2),partial [orb1651630]
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial (orb3053901)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review