Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG)-VLPs, Fluorescent

• Catalog Number: orb2659605
• Category: Proteins
• Description: Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG)-VLPs, Fluorescent
• Tag: C-terminal EGFP-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Purity: The purity information is not available for VLPs proteins.
• Protein Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
• Protein Length: Full Length of Mature Protein
• UniProt ID: Q16653
• MW: 55.9 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Endotoxins: Not test.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Expression Region: 30-247aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Note: For research use only

Detected by Mouse anti-GFP monoclonal antibody.

The purity of VLPs was greater than 95% as determined by SEC-HPLC