You have no items in your shopping cart.
Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs
SKU: orb2280230
Featured
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 56.4 kDa |
| Expression Region | 1-505aa |
| Protein Length | Full Length |
| Protein Sequence | MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT |
| Purity | The purity information is not available for VLPs proteins. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MCT 6;Monocarboxylate transporter 5;MCT 5;Solute carrier family 16 member 5

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs (orb2280230)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review