You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1495030 |
|---|---|
| Category | Proteins |
| Description | CCL18, is a novel CC chemokine that is highly homologous to MIP-1α (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-γ. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils. |
| Form/Appearance | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
| Buffer/Preservatives | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Purification | >97% by SDS-PAGE and HPLC analyses. |
| Protein Sequence | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| MW | 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
| Endotoxins | Less than 1EU/mg of rHuMIP-4/CCL18 as determined by LAL method. |
| Source | Escherichia coli |
| Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg. |
| Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review