You have no items in your shopping cart.
Recombinant Human Interleukin-3 (IL3) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 17.1 kDa |
| Expression Region | 20-152aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human IL-3 protein (Active, HEK293) [orb1817175]
>95% as determined by SDS-PAGE
25-40 kDa
10 μg, 50 μg, 500 μgRecombinantIL-3,Mouse [orb1494820]
> 95% by SDS-PAGE analysis.
15.2 kDa, observed by non-reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μgRecombinantIL-3,Human [orb1494821]
> 95% as analyzed by SDS-PAGE and HPLC.
15.2 kDa, observed by non-reducing SDS-PAGE.
Escherichia coli.
10 μg, 50 μg, 1 mgRecombinant human IL-3 protein (Active, E.coli) [orb2978628]
≥ 95% as determined by SDS-PAGE.
15.1 kDa
10 μg, 50 μg, 500 μgRecombinant Human Interleukin-3 (IL3) (Active) [orb2986833]
Greater than 95% as determined by SDS-PAGE.
16.5 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interleukin-3 (IL3) (Active) (orb2666680)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
