You have no items in your shopping cart.
Recombinant Human Interleukin-13 (IL13)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 20.2 kDa |
| Expression Region | 25-146aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Interleukin-13 (IL13) [orb2666711]
Greater than 95% as determined by SDS-PAGE.
13.8 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Human Interleukin-13 (IL13) [orb2666662]
Greater than 95% as determined by SDS-PAGE.
14.8 kDa
Yeast
20 μg, 1 mg, 100 μgRecombinant Human Interleukin-13 (IL13) [orb2666663]
Greater than 95% as determined by SDS-PAGE.
15.3 kDa
Yeast
1 mg, 100 μg, 20 μgDonzakimig Human Monoclonal Antibody [orb2976322]
ELISA, FA, FACS, In vivo
Human
Human Humanized
Monoclonal
Unconjugated
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interleukin-13 (IL13) (orb2666505)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




