You have no items in your shopping cart.
Recombinant Human Interferon alpha-2 (IFNA2)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-KSI-tagged |
| Molecular Weight | 34.6 kDa |
| Expression Region | 24-188aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−IFNA2 Antibody [orb238388]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μlRecombinant Human Interferon alpha-2 (IFNA2) (Active) [orb2659094]
Greater than 95% as determined by SDS-PAGE.
22.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μgHuman IFN alpha2a [orb3002344]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.24 KDa. Observed: 16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IFN alpha2b [orb3002431]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified). SEC-HPLC: Greater than 90% as determined by SEC-HPLC. (QC verified)
Predicted: 19.4 KDa. Observed: 17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman IFN alpha2a Protein [orb1471756]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
19.24 KDa
Mammalian
10 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Interferon alpha-2 (IFNA2) (orb1785527)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









