You have no items in your shopping cart.
Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)
SKU: orb3004690
Description
Images & Validation
−
Key Properties
−| Expression System | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 21-115 |
| Protein Length | 95 |
| Protein Sequence | EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxins | Not test |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Immunoglobulin kappa variable 3D-11 IGKV3D-11
Similar Products
−Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) [orb3007155]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated [orb3005922]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated [orb3008387]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) [orb3009619]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) [orb3010845]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) (orb3004690)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review