Recombinant Human immunodeficiency virus 1 Protein Rev (rev)

SKU: orb1674762

Description

This Recombinant Human immunodeficiency virus 1 Protein Rev (rev) spans the amino acid sequence from region 1-107aa. Purity: Greater than 85% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.coli
• Biological Origin: Human immunodeficiency virus 1
• Tag: N-terminal 10xHis-tagged
• Molecular Weight: 18.1 kDa
• Expression Region: 1-107aa
• Protein Length: Full Length
• Protein Sequence: MAGGNEDRDEELLRAVRIIKILYQSNPYPEPRGTRQARKNRRRRWRARQRQIHSISERILSACLGRPAEPVPLQLPPIERLHISGSESVGTSGTQQSQGTTEGVGSP
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

V9MMW3