Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs

• Catalog Number: orb1881838
• Category: Proteins
• Description: Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs
• Tag: C-terminal 10xHis-tagged & C-terminal Flag-tagged (This tag can be tested only under denaturing conditions)
• Form/Appearance: Lyophilized powder
• Purity: The purity information is not available for VLPs proteins.
• MW: 28.3 kDa&27.0 kDa
• UniProt ID: P01903, D7RIG5
• Protein Sequence: GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS&IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL
• Protein Length: Heterodimer
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Not Test
• Expression Region: 30-266aa&26-254aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Expiration Date: 6 months from date of receipt.

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by SEC-HPLC