You have no items in your shopping cart.
Recombinant Human Fibroblast growth factor 5 (FGF5)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Molecular Weight | 62.4 kDa |
| Expression Region | 21-268aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human FGF5 Protein, N-His [orb2963968]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
18.34 kDa
1 mg, 50 μg, 100 μgHuman FGF5 Protein [orb1477994]
Greater than 90% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Human Fibroblast growth factor 5 (FGF5) [orb2658971]
Greater than 90% as determined by SDS-PAGE.
34.2 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Human FGF5 Protein, N-His [orb2832831]
>90% as determined by SDS-PAGE.
18.34 kDa
20 μg, 50 μg, 100 μgHuman FGF5 protein [orb754096]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
27.5 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Fibroblast growth factor 5 (FGF5) (orb2659853)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review