You have no items in your shopping cart.
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal mFc-tagged |
| Expression Region | 1-118aa |
| Protein Length | Full Length |
| MW | 12.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human EIF4EBP1 Protein [orb2995202]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 14.74 KDa. Observed: 20 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) [orb2658934]
Greater than 85% as determined by SDS-PAGE.
19.4 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Human EIF4EBP1 Protein, N-His [orb2967952]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
14.74 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) (orb2986435)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



