You have no items in your shopping cart.
Recombinant Human Erythropoietin (EPO) (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3587-9.417 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 20.4 kDa |
| Expression Region | 28-193aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Erythropoietin (EPO) (Active) [orb2658096]
Greater than 90% as determined by SDS-PAGE.
21.2 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant human EPO protein (Active, HEK293) [orb1817181]
>95% as determined by SDS-PAGE
36-40 kDa
10 μg, 50 μg, 500 μgRecombinant human EPO protein (Active, HEK293) [orb2328790]
>95% as determined by SDS-PAGE
54-67 kDa
10 μg, 50 μg, 500 μgRecombinant human EPO protein (Active, CHO) [orb3124184]
≥ 95% as determined by SDS-PAGE.
18.3 kDa
500 μg, 50 μg, 10 μgRecombinant Human Erythropoietin (EPO) (Active) [orb2657934]
Greater than 95% as determined by SDS-PAGE.
18.3 kDa
Mammalian cell
1 mg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Erythropoietin (EPO) (Active) (orb2666694)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


