You have no items in your shopping cart.
Recombinant Human Erythropoietin protein(EPO) (Active)
SKU: orb1650726
Active
Description
Images & Validation
−
Key Properties
−| Expression System | Mammalian cell |
|---|---|
| Biological Activity | Fully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and was found to be no less than 1.5 105 IU,mg. |
| Tag | NO-tagged |
| Molecular Weight | 21.0 kDa |
| Protein Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Purity | >98% as determined by SDS-PAGE and HPLC. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Sterile filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid), liquid |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Epoetin,
Similar Products
−Recombinant Human Erythropoietin protein(EPO) (Active) [orb1650727]
>98% as determined by SDS-PAGE and HPLC.
21.0 kDa
500 IU, 37500 IU, 75000 IU, 15000 IU, 2000 IU

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Erythropoietin protein(EPO) (Active) (orb1650726)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review