You have no items in your shopping cart.
Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial
SKU: orb1652811
Description
Research Area
Molecular Biology
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Tag | N-terminal 6xHis-SUMO-tagged |
| MW | 43.4 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer 50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−DNA-directed RNA polymerase III largest subunitDNA-directed RNA polymerase III subunit ARNA polymerase III 155KDA subunit ;RPC155RNA polymerase III subunit C160
Similar Products
−Recombinant Human DNA-directed RNA polymerase III subunit RPC1 (POLR3A), partial [orb1674852]
Greater than 90% as determined by SDS-PAGE.
31.4 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial (orb1652811)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review