Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial

SKU: orb1652811

Description

Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial

Research Area

Molecular Biology

Key Properties

• Expression System: E.coli
• Tag: N-terminal 6xHis-SUMO-tagged
• MW: 43.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
• Buffer/Preservatives: Tris-based buffer 50% glycerol
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DNA-directed RNA polymerase III largest subunitDNA-directed RNA polymerase III subunit ARNA polymerase III 155KDA subunit ;RPC155RNA polymerase III subunit C160