Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial

• Catalog Number: orb1652811
• Category: Proteins
• Description: Recombinant Human DNA-directed RNA polymerase III subunit RPC1(POLR3A),partial
• Species/Host: E. coli
• Tag: N-terminal 6xHis-SUMO-tagged
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 43.4 kDa
• Protein Sequence: FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC
• Expression System: E.coli
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C. Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
• Buffer/Preservatives: Tris-based buffer 50% glycerol
• Alternative names: DNA-directed RNA polymerase III largest subunitDNA
• Note: For research use only
• Expiration Date: 6 months from date of receipt.